CDK2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57327PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-57327PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all CDK2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDK2.

Source: E. coli

Amino Acid Sequence: PSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRIS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57327.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57327PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CDK2

The protein encoded by the Cdk2 gene is a member of the Ser/Thr protein kinase family. This protein kinase is highlysimilar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. It is a catalytic subunit of thecyclin-dependent protein kinase complex, whose activity is restricted to the G1-S phase, and essential for cell cycleG1/S phase transition. This protein associates with and regulated by the regulatory subunits of the complex includingcyclin A or E, CDK inhibitor p21Cip1 (CDKN1A) and p27Kip1 (CDKN1B). Its activity is also regulated by its proteinphosphorylation. Two alternatively spliced variants and multiple transcription initiation sites of this gene have beenreported. (provided by RefSeq)

Long Name

Cyclin-dependent Kinase 2

Alternate Names

cdc2-related protein kinase, cell devision kinase 2, Cell division protein kinase 2, cyclin-dependent kinase 2, EC 2.7.11, EC 2.7.11.22, p33 protein kinase, p33(CDK2)

Gene Symbol

CDK2

Additional CDK2 Products

Product Documents for CDK2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CDK2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.