CEBP gamma Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89742PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89742PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all CEBP gamma Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEBPG.

Source: E. coli

Amino Acid Sequence: GVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89742.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89742PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CEBP gamma

The transcription factor C/EBP alpha (CCAAT-enhancer binding protein) is a heatstable, sequence-specific DNA-binding protein first purified from rat liver nuclei that binds avidly to several different cis-regulatory DNA sequences commonly associated with viral and cellular genes transcribed by RNA polymerase II. C/EBP alpha regulates gene expression in a variety of tissues including liver, adipose, lung and intestine. C/EBP alpha uses a bipartite structural motif to bind DNA. Two protein chains dimerize through a set of amphipathic alpha helices termed the leucine zipper. Highly basic polypeptide regions emerge from the zipper to form a linked set of DNA contact surfaces. C/EBP alpha appears to function exclusively in terminally differentiated, growth-arrested cells. Additional family members include C/EBP beta, C/EBP gamma,C/EBP delta and C/EBP episilon, all of which exhibit similar DNA-binding specificities and affinities to C/EBP alpha. Furthermore, C/EBP beta and C/EBP delta readily form heterodimers both with each other as well as with C/EBP alpha.

Alternate Names

c/EBP gamma, CCAAT/enhancer binding protein (C/EBP), gamma, CCAAT/enhancer-binding protein gamma, GPE1BP, IG/EBP-1

Gene Symbol

CEBPG

Additional CEBP gamma Products

Product Documents for CEBP gamma Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CEBP gamma Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.