Skip to main content

CFTR Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16990PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16990PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CFTR

Source: E. coli

Amino Acid Sequence: FESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-16990.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-16990PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CFTR

Cystic fibrosis transmembrane conductance regulator (CFTR) is a multi-pass transmembrane protein that functions as a chloride channel. CFTR belongs to the ATP-binding cassette (ABC) superfamily. Mutations in CFTR cause the pulmonary disease, cystic fibrosis (CF). Specifically, deletion of phenyalanine at position 508 (DeltaF508-CFTR) results in a folding defect which impairs chloride channel function. The mechanism by which channel dysfunction relates to disease symptoms is a focus of intense research. CFTR dysfunction results in disruption of ion transport and subsequent blockage of airways by secreted mucus. CFTR may also play a role in the skeletal muscle atrophy and dysfunction that characterizes CF. In addition, CFTR-mediated chloride secretion underlies fluid accumulation and cyst growth in autosomal dominant polycystic kidney disease (ADPKD).

Long Name

Cystic Fibrosis Transmembrane Conductance Regulator

Alternate Names

ABC35, ABCC7CF, ATP-binding cassette sub-family C member 7, ATP-binding cassette transporter sub-family C member 7, cAMP-dependent chloride channel, CFTR/MRP, Channel conductance-controlling ATPase, cystic fibrosis transmembrane conductance regulator, cystic fibrosis transmembrane conductance regulator (ATP-binding cassettesub-family C, member 7), cystic fibrosis transmembrane conductance regulator, ATP-binding cassette(sub-family C, member 7), dJ760C5.1, EC 3.6.3, MRP7EC 3.6.3.49, TNR-CFTR

Gene Symbol

CFTR

Additional CFTR Products

Product Documents for CFTR Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CFTR Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...