Skip to main content

CHD9 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17228PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17228PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHD9

Source: E. coli

Amino Acid Sequence: SLRSQQNRNNLNPGQNSLSQSKNFMNVSGPHRVNVNHPPQMTNASNSQQSISMQQFSQTSNPSAHFHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNHISPNSLLQSSA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17228.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17228PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CHD9

CHD9/CReMM is a member of the CHD (chromodomain-helicase-DNA-binding) family of proteins that interacts with nucleosomes and plays a role in chromatin remodeling to modulate transcription. The members of the CHD family of proteins possess 3 common structural and functional domains: a chromodomain (chromatin organization modifier), an SNF2-like helicase/ATPase domain, and a C-terminal DNA-binding domain. CHD9/CReMM is thought to play a role in development due to its role in tissue-specific gene transcription. CHD9/CReMM also functions as a PPARA transcriptional coactivator. Alternate names for CHD9/CreMM include chromodomain-helicase-DNA-binding protein 9, ATP-dependent helicase CHD9, chromatin-related mesenchymal modulator, chromatin-remodeling factor CHROM1, PPARA-interacting complex 320 kDa protein, kismet homolog 2, KIAA0308, KISH2, AD013, and PRIC320.

Alternate Names

AD013, ATP-dependent helicase CHD9, BC022889, CHD-9, chromatin remodeling factor CHROM1, Chromatin-related mesenchymal modulator, Chromatin-remodeling factor CHROM1, chromodomain helicase DNA binding protein 9, chromodomain-helicase-DNA-binding protein 9, ciprofibrate bound protein p240, CReMM, EC 3.6.1, EC 3.6.4.12, FLJ12178, KIAA0308, KISH2, Kismet homolog 2, Peroxisomal proliferator-activated receptor A-interacting complex 320 kDaprotein, PPAR{gamma}-interacting cofactor 320 kDa, PPAR-alpha-interacting complex protein 320 kDa, PRIC320, proteinx0008

Gene Symbol

CHD9

Additional CHD9 Products

Product Documents for CHD9 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CHD9 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...