Chk2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90024PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-90024PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Chk2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHEK2.

Source: E. coli

Amino Acid Sequence: TSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90024.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-90024PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Chk2

In response to DNA damage and replication blocks, cell cycle progression is halted through the control of critical cell cycle regulators. The protein encoded by this gene is a cell cycle checkpoint regulator and putative tumor suppressor. It contains a forkhead-associated protein interaction domain essential for activation in response to DNA damage and is rapidly phosphorylated in response to replication blocks and DNA damage. When activated, the encoded protein is known to inhibit CDC25C phosphatase, preventing entry into mitosis, and has been shown to stabilize the tumor suppressor protein p53, leading to cell cycle arrest in G1. In addition, this protein interacts with and phosphorylates BRCA1, allowing BRCA1 to restore survival after DNA damage. Mutations in this gene have been linked with Li-Fraumeni syndrome, a highly penetrant familial cancer phenotype usually associated with inherited mutations in TP53. Also, mutations in this gene are thought to confer a predisposition to sarcomas, breast cancer, and brain tumors. This nuclear protein is a member of the CDS1 subfamily of serine/threonine protein kinases. Three transcript variants encoding different isoforms have been found for this gene.

Long Name

Checkpoint Kinase 2

Alternate Names

CDS1, CHEK2, HuCds1, LFS2, PP1425, Rad53

Gene Symbol

CHEK2

Additional Chk2 Products

Product Documents for Chk2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Chk2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.