CLEC14A Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56335PEP
Key Product Details
Source
E. coli
Tag
N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLEC14A.
Source: E. coli
Amino Acid Sequence: RCAVLQATGGVEPAGWKEMRCHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGTEVS
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56335.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP2-56335PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: CLEC14A
CLEC14A (C-type lectin domain family 14 member A; also EGFR5) is a 51 kDa (predicted) member of the C-type lectin domain family of proteins. It is a type I transmembrane protein, apparently expressed in brain and about which little is known. Mature human CLEC14A is 469 amino acids in length. It contains a 376 aa extracellular region (aa 22-397) and a 72 aa cytoplasmic domain. The extracellular region shows one C-type lectin like domain (aa 32-175) and an EGF-like region (aa 245-287). Over aa 22-397, human CLEC14A shares 66% and 81% aa identity with mouse and canine CLEC14A, respectively.
Long Name
C-type Lectin Domain Family 14, Member A
Alternate Names
CEG1, EGF R5
Gene Symbol
CLEC14A
Additional CLEC14A Products
Product Documents for CLEC14A Recombinant Protein Antigen
Product Specific Notices for CLEC14A Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...