Skip to main content

CRMP5 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85461PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-85461PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DPYSL5.

Source: E. coli

Amino Acid Sequence: GRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRTPYL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85461.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-85461PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CRMP5

The collapsin response mediator protein (CRMP) family of proteins (also referred to as ULIP6) are a group of neurologic proteins that have been found to play key roles in growth cone guidance during neural development. CRMP5 has relatively low sequence homology with the other four members of the CRMP family. CRMP5 is expressed in the developing nervous system in an expression pattern that resembles CRMP2 and has a peak expression during the first postnatal week. Elevated levels of autoantibody to CRMP5 have been shown to be linked paraneoplastic autoimmune optic neuritis and other paraneoplastic neoplasms. Auto-immunity against CRMP5 expression (predominantly the N-terminal epitopes) is also being investigated as an oncological marker in the respiratory system and in the thymus.

Alternate Names

Collapsin response mediator protein 5, collapsin response mediator protein-5, CRAMCRMP3-associated molecule, CRMP-5FLJ45383, CRMP5UNC33-like phosphoprotein 6, dihydropyrimidinase-like 5, dihydropyrimidinase-related protein 5, DRP-5, Ulip6, ULIP-6

Gene Symbol

DPYSL5

Additional CRMP5 Products

Product Documents for CRMP5 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CRMP5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...