Skip to main content

CRTAC1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88864PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-88864PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRTAC1.

Source: E. coli

Amino Acid Sequence: VVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88864.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-88864PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CRTAC1

CRTAC1 (cartilage acidic protein 1; also CEP-68) is a 95-105 kDa member of a novel family of EGF domain-containing proteins. It is secreted by articular chondrocytes and may play a role in either cartilage matrix organization, or cell-matrix adhesion. Mature human CRTAC1 is 634 amino acids (aa) in length. It contains four FG-GAP (PheGly-GlyAlaPro) domains (aa 46-437) and one EGF-like motif (aa 559-605). Multiple splice forms exist. There are two alternate start sites at Met9 and Met211 that may be accompanied by a 39 aa substitution for the C-terminal 55 aa, or an 84 aa substitution for aa 545-661. Over aa 28-661, human CRTAC1 shares 91% aa identity with mouse CRTAC1. This form in mouse, however, is more equivalent to the human isoform that shows a C-terminal 39 aa substitution. In this case, there is 95% aa identity between mouse and human.

Long Name

Cartilage Acidic Protein 1

Alternate Names

ASPIC1, CEP68

Gene Symbol

CRTAC1

Additional CRTAC1 Products

Product Documents for CRTAC1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CRTAC1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...