Recombinant Human CTDSPL2 GST (N-Term) Protein

Name: Recombinant Human CTDSPL2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00051496-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00051496-P01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00051496-P01 has been discontinued. View all CTDSPL2 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all CTDSPL2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-466 of Human CTDSPL2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPKEERENPSKRSRIERDIDNNLITSTPRAGEKPNKQISRVRRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPSLNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

79.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human CTDSPL2 GST (N-Term) Protein

SDS-PAGE: Recombinant Human CTDSPL2 GST (N-Term) Protein [H00051496-P01]

SDS-Page: Recombinant Human CTDSPL2 Protein [H00051496-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00051496-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: CTDSPL2

CTDSPL2, also known as CTD small phosphatase-like protein 2, is a 54kDa 466 amino acid protein with a shorter 45kDa 394 isoform. Current research on CTDSPL2 is being conducted in relation to sarcoma. The gene is linked to the RNA processing pathway where it interacts with UBC and ELAVL1.

Alternate Names

CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase like 2, CTD small phosphatase-like protein 2, CTDSP-like 2, EC 3.1.3, EC 3.1.3.-, EC 3.1.3.16, FLJ10523, HSPC129

Gene Symbol

CTDSPL2

Additional CTDSPL2 Products

Product Documents for Recombinant Human CTDSPL2 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human CTDSPL2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews