CXCR3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38547PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38547PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all CXCR3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CXCR3.

Source: E. coli

Amino Acid Sequence: QVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38547.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38547PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CXCR3

CXCR3, also known as GPR9, is a member of the CXC chemokine receptor subfamily. Similar to other chemokine receptors, it is a G protein-coupled receptor (GPCR). In humans, two alternatively spliced CXCR3 isoforms, CXCR3 and CXCR3B, have been identified and have different chemokine binding affinities. Human CXCR3 is 368 amino acids (aa) in length with a predicted molecular weight of 41 kDa. CXCR3B contains an additional N-terminal sequence and is 415 aa in length with a predicted molecular weight of 46 kDa. Mouse and rat CXCR3 share 86% aa sequence identity with human CXCR3. CXCR3 is expressed on leukocytes and is upregulated following T cell activation. It binds multiple CXC chemokines and is known to mediate leukocyte trafficking. CXCR3 has been implicated in neuroinflammatory and autoimmune diseases.

Alternate Names

CD183, CXCR3, GPR9

Gene Symbol

CXCR3

Additional CXCR3 Products

Product Documents for CXCR3 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CXCR3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.