Cyclophilin A Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-46850PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: FGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
Protein / Peptide Type
Formulation, Preparation and Storage
NBP2-46850PEP
Formulation | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Cyclophilin A
Cyclophilin A, also known as Peptidylprolyl Isomerase A, PPIA, CYPA, and CYPH, was originally characterized for its ability to catalyze the transition between cis and trans proline residues critical for proper folding of proteins. Ubiquitously expressed, Cyclophilin A has a predicted molecular weight of 17 kDa and is proinflammatory cytokine that is secreted in response to inflammatory stimuli. Human Cyclophilin A shares 95% amino acid identity with both the mouse and rat orthologs. Cyclophilin A is the main target of the immunosuppressive drug Cyclosporin A. The immunosuppressive activity of cyclosporins has been correlated with their ability to form complexes with cyclophilins that inhibit Calcineurin Phosphatase activity and prevent incorporation of Cyclophilin A into viral particles. Cyclophilin A is known to be incorporated into many viruses, including HIV1 and Hepatitis C, where it may be involved in functions such as viral assembly, replication, and infectivity. In addition, Cyclophilin A has been shown to promote atherosclerosis via binding to Extracellular matrix metalloproteinase (MMP) inducer (EMMPRIN) on CD34+ progenitor cells and stimulating differentiation to foam cells, an essential step during atherosclerotic plaque formation in blood vessels. Cyclophilin A-induced disruption of blood-brain barrier function is thought to contribute to the increased risk of developing Alzheimer’s disease in individuals that possess one or two Apolipoprotein E4 alleles.
Alternate Names
Gene Symbol
Additional Cyclophilin A Products
Product Documents for Cyclophilin A Recombinant Protein Antigen
Product Specific Notices for Cyclophilin A Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.