Skip to main content

CYFIP2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57502PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57502PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYFIP2.

Source: E. coli

Amino Acid Sequence: STQACQWSPRALFHPTGGTQGRRGCRSLLY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57502.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57502PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CYFIP2

CYFIP2, also known as Cytoplasmic FMR1-interacting protein 2, includes a 148 kDa and a 146 kDa isoform, and is involved in the initiation of apoptosis and T-cell adhesion. Disease research is currently being conducted to determine the relationship between CYFIP2 and multiple sclerosis, gout, and asthma. The protein has been linked to the Rac1 Pathway, ErbB1 downstream signaling, regulation of actin cytoskeleton, and the immune system. In these pathways and biological processes, CYFIP2 interacts with ABI1, FXR1, GAS7, FXR2, and ABI3.

Alternate Names

cytoplasmic FMR1 interacting protein 2, cytoplasmic FMR1-interacting protein 2, KIAA1168, p53 inducible protein, PIR121p53-inducible protein 121

Gene Symbol

CYFIP2

Additional CYFIP2 Products

Product Documents for CYFIP2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CYFIP2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...