Recombinant Human Cysteinyl Leukotriene R1/CysLTR1 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00010800-P01
![SDS-PAGE: Recombinant Human Cysteinyl Leukotriene R1/CysLTR1 GST (N-Term) Protein [H00010800-P01] SDS-PAGE: Recombinant Human Cysteinyl Leukotriene R1/CysLTR1 GST (N-Term) Protein [H00010800-P01]](https://resources.bio-techne.com/images/products/qc_test-H00010800-P01-1.jpg)
Key Product Details
Source
Tag
Conjugate
Applications
Product Specifications
Description
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Protein / Peptide Type
Scientific Data Images
SDS-PAGE: Recombinant Human Cysteinyl Leukotriene R1/CysLTR1 GST (N-Term) Protein [H00010800-P01]
SDS-Page: Recombinant Human Cysteinyl Leukotriene R1/CysLTR1 Protein [H00010800-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.Formulation, Preparation and Storage
H00010800-P01
Preparation Method | in vitro wheat germ expression system |
Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative | No Preservative |
Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: Cysteinyl Leukotriene R1/CysLTR1
Long Name
Alternate Names
Gene Symbol
Additional Cysteinyl Leukotriene R1/CysLTR1 Products
Product Specific Notices
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.