Recombinant Human Cytokeratin 7 GST (N-Term) Protein

Name: Recombinant Human Cytokeratin 7 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00003855-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00003855-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all Cytokeratin 7 Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-469 of Human KRT7

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

77.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Cytokeratin 7 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00003855-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Cytokeratin 7

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. [provided by RefSeq]

Alternate Names

CK-7, CK7, K2C7, K7

Gene Symbol

KRT7

Additional Cytokeratin 7 Products

Product Documents for Recombinant Human Cytokeratin 7 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Cytokeratin 7 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews