Recombinant Human Cytokeratin, HMW GST (N-Term) Protein

Name: Recombinant Human Cytokeratin, HMW GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00051350-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00051350-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all Cytokeratin, HMW Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-638 of Human KRT76

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGAGGGACGFRSGAGSFGSRSLYNLGSNKSISISVAAGSSRAGGFGGGRSSCGFAGGYGGGFGGSYGGGFGGGRGVGSGFGGAGGFGGAGGFGGPGVFGGPGSFGGPGGFGPGGFPGGIQEVIVNQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFKKKYEDEINKRTAAENEFVGLKKDVDAAFMNKVELQAKVDSLTDEVSFLRTLYEMELSQMQSHASDTSVVLSMDNNRCLDLGSIIAEVRTQYEEIAQRSKSEAEALYQTKLGELQTTAGRHGDDLRNTKSEIMELNRMIQRLRAEIENVKKQNANLQTAIAEAEQRGEMALKDANAKLQDLQTALQKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGECQSAVCISVVSNVTSTSGSSGSSRGVFGGVSGSGSGGYKGGSSSSSSSGYGVSGGSGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

92.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Cytokeratin, HMW GST (N-Term) Protein

SDS-PAGE: Recombinant Human Cytokeratin, HMW GST (N-Term) Protein [H00051350-P01]

SDS-Page: Cytokeratin, HMW Recombinant Protein [H00051350-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00051350-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Cytokeratin, HMW

KRT76, also known as Keratin, type II cytoskeletal 2 oral, is a 638 amino acid that is approx. 66 kDa, belongs to the intermediate filament family responsible for the structural integrity of epithelial cells, subdivided into epithelial keratins and hair keratins, and probably contributes to terminal cornification. Studies are being performed in relation to this protein and obstructive jaundice, pharyngitis, jaundice, cervical cancer, neuronitis, colorectal cancer, cervicitis, interferon and hepatitis. This protein has been shown to have interactions with ATG13, PDPK1, ULK2, GABARAP, and PRKAA1 in cytoskeleton organization pathways.

Alternate Names

CK-2P, cytokeratin 2, Cytokeratin-2P, HUMCYT2A, K2P, K76, keratin 76, keratin, type II cytoskeletal 2 oral, keratin-76, KRT2Bcytokeratin-2P, KRT2Pkeratin 2p, KRT76, Type-II keratin Kb9

Gene Symbol

KRT76

Additional Cytokeratin, HMW Products

Product Documents for Recombinant Human Cytokeratin, HMW GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Cytokeratin, HMW GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews