Recombinant Human DAPP1 GST (N-Term) Protein

Name: Recombinant Human DAPP1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00027071-P02

Novus Biologicals, part of Bio-Techne | Catalog # H00027071-P02

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all DAPP1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-280 of Human DAPP1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

58.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human DAPP1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human DAPP1 GST (N-Term) Protein [H00027071-P02]

SDS-Page: Recombinant Human DAPP1 Protein [H00027071-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00027071-P02

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: DAPP1

B cell adapter molecule (BAM32) is also designated a dual adapter for phosphotyrosine and 3-phosphotyrosine, and 3-phosphoinositide (DAPP1) or B lymphocyte adapter protein. BAM32 is a B cell-associated adapter that is crucial for B cell antigen receptor signaling regulation. BAM32 interacts with Ptdlns and PLC gamma2 and, upon B cell activation, the protein is phosphorylated on tyrosine residues. It is a mainly cytoplasmic protein that can translocate to the cell membrane after cell stimulation. BAM32, which contains one PH domain and one SH2 domain, is primarily expressed in placenta and lung tissues, but can also be detected in heart, liver, pancreas and brain.

Long Name

Dual Adaptor of Phosphotyrosine and 3-Phosphoinositides 1

Alternate Names

BAM32

Gene Symbol

DAPP1

Additional DAPP1 Products

Product Documents for Recombinant Human DAPP1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human DAPP1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews