Skip to main content

DUOX1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-81301PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-81301PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DUOX1.

Source: E. coli

Amino Acid Sequence: QHKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81301.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-81301PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DUOX1

The DUOX1 gene encodes a glycoprotein dual oxidase 1 protein with an isoform 1 of 1,551 amino acids long at 177 kDA and an isoform 2 at 1,197 amino acids long at 137 kDA. This protein is called a dual oxidase because it obtains a peroxidase homology domain and a gp91phox domain. DUOX1 generates hydrogen peroxide which is essential for thyroid peroxidase/TPO and lactoperoxidase/LPO, as well as lactoperoxidase-mediated antimicrobial defense. DUOX1 interacts with genes TXNDC11 and TPO and has been investigated for its role in various diseases such as thyroiditis, lung cancer, alcoholism, carcinoma, chronic obstructive pulmonary disease, hypothyroidism, hepatitis, prostatitis, and chronic granulomatous disease.

Alternate Names

dual oxidase 1, DUOX, EC 1.11.1.-, EC 1.6.3.1, Large NOX 1, LNOX1flavoprotein NADPH oxidase, Long NOX 1, MGC138840, NADPH thyroid oxidase 1, nicotinamide adenine dinucleotide phosphate oxidase, NOXEF1, THOX1MGC138841, Thyroid oxidase 1

Gene Symbol

DUOX1

Additional DUOX1 Products

Product Documents for DUOX1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DUOX1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...