Recombinant Mouse GITR Ligand/TNFSF18 Protein

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-26579

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-26579
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Conjugate

Unconjugated

Applications

Functional Assay, SDS-PAGE

View all GITR Ligand/TNFSF18 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein corresponding to TNFSF18.

Amino Acid Sequence: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS.

Human IgG Fc in italics

Extracellular domain of murine GITRL is underlined

Purity

Protein A purified

Endotoxin Level

Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test.

Predicted Molecular Mass

39.78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

In vitro proliferation assay, in vivo assays.

Applications

Functional (reported in scientific literature (PMID 24633226))
In vitro assay (reported in scientific literature (PMID 24633226))

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Mouse GITR Ligand/TNFSF18 Protein

Functional: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579]

Functional: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579]

Functional: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579] - Demonstration of the potency of Fc-mGITRL in comparison to an agonist anti-mGITR antibody (IMG-5920A, clone DTA-1) and anti-CD28 in the presence of anti-CD3. Anti-CD3 antibody serves as a negative control for co-stimulation.
SDS-PAGE: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579]

SDS-PAGE: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579]

SDS-Page: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579] - SDS-PAGE analysis of recombinant Fc-mGITRL to demonstrate purity of protein.

Formulation, Preparation and Storage

NBP2-26579
Formulation Phosphate-buffered solution, pH 7.2, containing no preservative. 0.2 um filter sterilized.
Concentration 2 mg/ml
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: GITR Ligand/TNFSF18

The Glucocorticoid- Induced TNFR -Related gene (GITR) is a newly identified member of Tumor Necrosis factor Receptor Super Family (TNFRSF). The cytoplasmic domain of GITR is highly homologous to other TNFRSF members such as CD137, OX40 and CD40. The ligand for GITR is GITRL, which is a type II transmembrane protein that is normally expressed on the surface of antigen presenting cells, including macrophages and dendrtic cells. The cell surface marker GITR has been shown to be constitutively expressed at high levels on the surface of murine CD4+/CD25+ cells, known as Treg cells, and also up regulated on activated CD4+ and CD8+ cells. Treg cells have a clearly established immunosuppressive role capable of thwarting the host immune response to tumors. Functionally, GITR has been described as an co-stimulatory receptor that promotes survival in early phases of T-cell activation The process through which GITR induces co-stimulation is complex, entailing IL-2 as well as counter-regulatory IL-10 production. High doses of IL-2 have been reported to produce Treg cell proliferation while rendering Treg cells less effective at their suppressive function. Though GITR is present on both effector T-cells and immunosuppressive Treg cells, the effects of the receptors ligation and signaling may differ between the two subpopulations. GITRL is known to produce a state of activation, perhaps by directly or indirectly abrogating the suppressive function of Treg cells, by activating effector T-cells, or perhaps through both mechanism. Fc-GITRL has been used effectively to eradicate solid tumors in mice in vivo. The use of the physiologic ligand to GITR may have advantages over the use of an agonist antibody, such as DTA-1, in that it's small size may have better tumor penetration, more favorable half-life kinetics, and more effective co-stimultaory activity.

Long Name

Glucocorticoid Induced TNF Receptor Family Related Gene Ligand

Alternate Names

AITRL, GITRL, TNFSF18

Gene Symbol

TNFSF18

Additional GITR Ligand/TNFSF18 Products

Product Documents for Recombinant Mouse GITR Ligand/TNFSF18 Protein

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Mouse GITR Ligand/TNFSF18 Protein

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.