Glut3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89762PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89762PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Glut3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC2A3.

Source: E. coli

Amino Acid Sequence: KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89762.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89762PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Glut3

Glucose is the major source of our energy and there are numerous isoforms of the glucose transporter in mammals, including Glut1, Glut2, Glut3, Glut4, Glut5, Glut6, Glut7, Glut8 and Glut9. The Glut5 gene located on the short arm of human chromosome 1 encodes a 501-amino acid facilitative glucose transporter. Glut5 mRNA is highly expressed in small intestine and to a lesser extent in kidney, skeletal muscle and adipose tissue. Glut5 plays a critical role in fructose absorption in the small intestine and its expression is highly induced when exposed to a fructose-enriched diet. Glut5 transporter expressed in human skeletal muscle is specifically localized to the plasma membrane, where it participates in regulating hexose transfer across the sarcolemma. Glut8, a novel glucose transporter-like protein, exhibits significant sequence similarity with the other members of sugar transporter family. Glut8 comprises 12 putative membrane-spanning helices and several conserved motifs, which are important for transport activity. In human tissues, Glut8 is predominantly expressed in testis and, to a lesser extent, in most other tissues including skeletal muscle, heart, small intestine and brain. In addition, the Glut8 glucose transport facilitator has a hormonally regulated testicular function.

Long Name

Glucose Transporter Type 3

Alternate Names

SLC2A3

Gene Symbol

SLC2A3

Additional Glut3 Products

Product Documents for Glut3 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Glut3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.