Recombinant Human Glut3 GST (N-Term) Protein

Name: Recombinant Human Glut3 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00006515-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00006515-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all Glut3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-496 of Human SLC2A3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTTNV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

80.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Glut3 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00006515-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Glut3

Glucose is the major source of our energy and there are numerous isoforms of the glucose transporter in mammals, including Glut1, Glut2, Glut3, Glut4, Glut5, Glut6, Glut7, Glut8 and Glut9. The Glut5 gene located on the short arm of human chromosome 1 encodes a 501-amino acid facilitative glucose transporter. Glut5 mRNA is highly expressed in small intestine and to a lesser extent in kidney, skeletal muscle and adipose tissue. Glut5 plays a critical role in fructose absorption in the small intestine and its expression is highly induced when exposed to a fructose-enriched diet. Glut5 transporter expressed in human skeletal muscle is specifically localized to the plasma membrane, where it participates in regulating hexose transfer across the sarcolemma. Glut8, a novel glucose transporter-like protein, exhibits significant sequence similarity with the other members of sugar transporter family. Glut8 comprises 12 putative membrane-spanning helices and several conserved motifs, which are important for transport activity. In human tissues, Glut8 is predominantly expressed in testis and, to a lesser extent, in most other tissues including skeletal muscle, heart, small intestine and brain. In addition, the Glut8 glucose transport facilitator has a hormonally regulated testicular function.

Long Name

Glucose Transporter Type 3

Alternate Names

SLC2A3

Gene Symbol

SLC2A3

Additional Glut3 Products

Product Documents for Recombinant Human Glut3 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Glut3 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews