Glyoxalase II/HAGH Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38502PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38502PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Glyoxalase II Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HAGH.

Source: E. coli

Amino Acid Sequence: NEKLVKLESGLKVYGGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAGC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38502.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38502PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Glyoxalase II

HAGH, also known as Hydroxyacylglutathione hydrolase mitochondrial, has a 308 amino acid long isoform that is 34 kDa and located in the mitochondrion matrix and a short 260 amino acid isoform that is 29 kDa and located in the cytoplasm; is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. Studies are being performed on the relationship of this protein to glyoxalase ii deficiency, breast carcinoma, carcinoma, familial Mediterranean fever, muscular dystrophy, thrombocytosis, neisseria meningitides, hyperglycemia, bladder carcinoma, alzheimer's disease, prostate cancer, hepatitis b, and prostatitis. HAGH protein involvement has been observed with relation to pyruvate metabolism, secondary metabolite metabolism, methylglyoxal degradation, and (R)-lactate from methylglyoxal pathways where it interacts with MYOC, PRDX2, VPS72, SOD1, and DR1.

Alternate Names

GLX2, HAGH

Gene Symbol

HAGH

Additional Glyoxalase II Products

Product Documents for Glyoxalase II/HAGH Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Glyoxalase II/HAGH Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.