hnRNP A2B1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89675PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89675PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all hnRNP A2B1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNRNPA2B1.

Source: E. coli

Amino Acid Sequence: VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89675.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89675PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: hnRNP A2B1

RNA polymerase II transcripts in the nucleus are in complex with several different proteins called heterogeneous nuclear ribonucleoproteins (hnRNPs). These proteins act in biological activities such as transcription, pre-mRNA processing, cytoplasmic mRNA ranslation, and turnover.2. hnRNPs can be isolated either by immunoprecipitation or by sucrose gradient fractionation of cell extracts. Isolated hnRNPs consist of protein groups named A to U and many of these protein groups consist of more than one isoform.3 The major steadystate proteins of the isolated hnRNP complex are the A1, A2, B1, B2, C1, and C2 with a range of molecular weights (34-43 kDa).3 hnRNP-A2/B1 proteins are located in the nucleus of most tissues cells; however, the hnRNP-A2 protein is found also in the cytoplasm of skin and esophagus cells. In rat brain, hnRNP-A2/B1 proteins are found in neurons in the cerebral cortices, hippocampal formation, olfactory regions, caudate-putamin, and the supraoptic ucleus of the hypothalamus.4 Expression of hnRNP-A2/B1 proteins was found also in lung development and its over expression correlated with lung cancer.5

Alternate Names

DKFZp779B0244, FLJ22720, heterogeneous nuclear ribonucleoprotein A2/B1, heterogeneous nuclear ribonucleoprotein B1, heterogeneous nuclear ribonucleoproteins A2/B1, hnRNP A2 / hnRNP B1, HNRNPA2, HNRNPB1, HNRPA2, HNRPA2B1hnRNP A2/B1, HNRPB1, nuclear ribonucleoprotein particle A2 protein, RNPA2, SNRPB1

Gene Symbol

HNRNPA2B1

Additional hnRNP A2B1 Products

Product Documents for hnRNP A2B1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for hnRNP A2B1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.