HOP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-92003PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-92003PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all HOP Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOPX.

Source: E. coli

Amino Acid Sequence: MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92003.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-92003PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HOP

HOP, also known as Homeodomain-only protein, has a 73 amino acid short isoform that is 8 kDa and a long 94 amino acid isoform that is 10 kDa; nucleus located; widely expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen; may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development; prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF; overexpression causes cardiac hypertrophy; and may also act as a tumor suppressor. Disease research is currently being studied with relation to choriocarcinoma, abdominal actinomycosis, nevus of ota, actinomycosis, lung cancer, nevus, carcinoma, squamous cell carcinoma, oral squamous cell carcinoma, esophageal squamous cell carcinoma, dilated cardiomyopathy, thyroid carcinoma, endometrial cancer, cardiomyopathy, gastric cancer, glioblastoma, esophagitis, and thyroiditis. This protein has shown an interaction with HDAC2, EPC1, SRF, GZMB, HOXB9, TLX3, and ZSCAN1 in the negative regulation of transcription from RNA polymerase II promoter, trophectodermal cell differentiation, transcription, DNA-dependent, regulation of transcription, DNA-dependent, and multicellular organismal development pathways.

Alternate Names

CAMEO, HOD, homeodomain-only protein, HOP homeobox, HOPLAGYNECC1OB1SMAP31, Lung cancer-associated Y protein, MGC20820, not expressed in choriocarcinoma clone 1, Not expressed in choriocarcinoma protein 1, odd homeobox 1 protein, Odd homeobox protein 1, TOTO

Gene Symbol

HOPX

Additional HOP Products

Product Documents for HOP Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HOP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.