HS3ST2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89374PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89374PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all HS3ST2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HS3ST2.

Source: E. coli

Amino Acid Sequence: APRCLRGPSAGGQKLLQKSRPCDPSGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDVRALGTEPHFFDRNYGRG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89374.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89374PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HS3ST2

HS3ST2 codes for a protein with a length of 367 amino acids and a weight of approximately 41.5 kDa, that is a sulfotransferase that utilizes PAPS and works to transfer a sulfo group to a glucosamine on heparan sulfate, without causing the heparan sulfate to being its anticoagulant form and is highly expressed in the brain with a lesser expression in the heart, lung and skeletal muscle. Current studies are being done on several diseases and disorders related to this gene including herpes simplex, chondrosarcoma, pancreatic cancer, colorectal cancer, pancreatitis, schizophrenia, and neuronitis. HS3ST2 has also been shown to have interactions with GLCE, GPC1, GPC2, GPC4, and GPC5 in pathways such as the heparan sulfate biosynthesis, metapathway biotransformation, Maroteaux-Lamy syndrome, metabolism, and Hunter syndrome pathways.

Alternate Names

EC 2.8.2, EC 2.8.2.29,3-OST-2, h3-OST-2, heparan sulfate (glucosamine) 3-O-sulfotransferase 2,30ST2,3OST2heparan sulfate glucosamine 3-O-sulfotransferase 2, Heparan sulfate 3-O-sulfotransferase 2, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2, heparin-glucosamine 3-O-sulfotransferase

Gene Symbol

HS3ST2

Additional HS3ST2 Products

Product Documents for HS3ST2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HS3ST2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.