Skip to main content

HS3ST3A1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56398PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56398PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HS3ST3A1.

Source: E. coli

Amino Acid Sequence: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56398.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56398PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HS3ST3A1

HS3ST3A1 codes for a protein with a length of 406 amino acids and a weight of approximately 45 kDa, that is a sulfotransferase that utilizes PAPS to facilitate in the transfer of a sulfo group to a glucosamine on heparan sulfate, which causes the heparan sulfate to become enzyme-modified and acts as a binding receptor to HSV-1 and permits its entry, and is most abundant in the heart and placenta. Current studies are being done on diseases and disorders relating to this gene including recurrent respiratory papillomatosis, herpes simplex, and scoliosis. HS3ST3A1 has also been shown to have interactions with EXT1, EXT2, GLCE, GPC1, and GPC2 in pathways such as the heparan sulfate biosynthesis, metapathway biotransformation, Maroteauc-Lamy syndrome, metabolism, and Hunter syndrome pathways.

Alternate Names

3-OST-3A, 3OST3A1heparan sulfate glucosamine 3-O-sulfotransferase 3A1,30ST3A1heparin-glucosamine 3-O-sulfotransferase, EC 2.8.2, EC 2.8.2.30, h3-OST-3A, heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1, Heparan sulfate 3-O-sulfotransferase 3A1, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, HS3ST3A

Gene Symbol

HS3ST3A1

Additional HS3ST3A1 Products

Product Documents for HS3ST3A1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HS3ST3A1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...