Hyaluronidase 1/HYAL1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83409PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-83409PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all Hyaluronidase 1/HYAL1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HYAL1.

Source: E. coli

Amino Acid Sequence: SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83409.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-83409PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Hyaluronidase 1/HYAL1

HYAL1 codes for a protein that may have a role in promoting tumor progression and blocking the TGFB1-enhanced cell growth, and is expressed highly in the liver, kidney, and heart, with weaker expression in the lung placenta, and skeletal muscle. There are seven isoforms of HYAL1, with the longest being isoform 1, which is only expressed in bladder and prostate cancer cells and is 435 amino acids long and weighs approximately 48 kDa. Current studies are being done on several diseases and disorders relating to this gene including lung carcinoma, lysosomal storage disease, diabetes mellitus, ovarian cancer, endometrial carcinoma, prostate cancer, and breast cancer. HYAL1 has also been shown to have interactions with GUSB, ARSB, IDUA, FAM107B, and COL2A1 in pathways such as the metabolic, lysosome, and Maroteaux-Lamy syndrome pathways.

Long Name

Hyaluronoglucosaminidase-1

Alternate Names

FUS2, HYAL1, Hyaluronoglucosaminidase 1, LUCA1, NAT6

Gene Symbol

HYAL1

Additional Hyaluronidase 1/HYAL1 Products

Product Documents for Hyaluronidase 1/HYAL1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Hyaluronidase 1/HYAL1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.