IFIT2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85617PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-85617PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all IFIT2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFIT2.

Source: E. coli

Amino Acid Sequence: RVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85617.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-85617PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IFIT2

Saha et al. used this antibody to study protein expression of murine GARG39/IFIT2 in relation to viral infection. Immunofluorescence localized this protein in association with the mitotic spindle in both mitotically active normal NIH3T3 and B16F10 melanoma cells. Western blotting shows approx. 55 kD band GARG39/IFIT2 in brain tissue of mice infected with Japanese encephalitis virus (JEV). Brain tissue from non-infected mice did not display this band. In 1994 Bluyssen et al. characterized the gene for murine GARG39/IFIT2 and historically the protein has been identified as interferon-induced protein with tetratricopeptide repeats 2 (IFIT-2), interferon-induced 54 kDa protein (IFI-54K), glucocorticoid-attenuated response gene 39 protein (GARG-39). Human IFIT2, with 62% amino acid sequence identity, has been referred to as Interferon-induced protein with tetratricopeptide repeats 2 (IFIT-2), Interferon-induced 54 kDa protein (IFI-54K) and ISG-54 K. Kang et al. showed with proteome analysis IFIT2 was expressed more than two-fold in human osteosarcoma cells U2OS treated with ascochlorin. Kawada et al. studied gene expression to show that IFIT2 is strongly upregulated in peripheral blood in children during the acute phase of influenza.

Alternate Names

cig42, G10P2IFI-54K, GARG-39, IFI-54, IFI54IFIT-2, IFI-54K, Interferon, alpha-inducible protein (MW 54kD), Interferon-induced 54 kDa protein, interferon-induced protein 54, interferon-induced protein with tetratricopeptide repeats 2, ISG54, ISG-54 K, ISG-54K, P54

Gene Symbol

IFIT2

Additional IFIT2 Products

Product Documents for IFIT2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IFIT2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.