Skip to main content

IGFBP-1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33475PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33475PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGFBP1.

Source: E. coli

Amino Acid Sequence: QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33475.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33475PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IGFBP-1

IGFBP1 is a gene that codes for an IGF-binding protein that circulates in the plasma and prolongs the half-life of IGFs and works to either inhibit of stimulate the growth promoting effects while also promoting cell migration and has a length of 259 amino acids and a weight of approximately 28 kDa. Current studies are being done on several diseases and disorders relating to this gene including protein-energy malnutrition, pre-eclampsia, persistent fetal circulation syndrome, Silver-Russell syndrome, growth hormone deficiency, Ehlers-Danlos syndrome, glucose intolerance, Prader-Willi syndrome, and chronic fatigue syndrome. IGFBP1 has also been shown to have interactions with IGF1, IGF2, MMP26, TF, and ARNT in pathways such as the myometrial relaxation and contraction, HIF-1-alpha transcription factor, IGF regulation, and protein metabolism pathways.

Long Name

Insulin-like Growth Factor Binding Protein 1

Alternate Names

IGFBP1

Gene Symbol

IGFBP1

Additional IGFBP-1 Products

Product Documents for IGFBP-1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IGFBP-1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...