IL-32 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82560PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-82560PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all IL-32 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL32.

Source: E. coli

Amino Acid Sequence: FPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82560.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-82560PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IL-32

IL32 alfa is the shortest of the 4 isotypes of IL32 known, it is 134 amino acids ( kDa) protein, the IL32B (beta) is 188, IL32C is 168 and IL32D is 179 amino acids long proteins. Each subtype has an N-terminal segment and four kringle domains (NK4), that interact with several other proteins including the hepatic growth factor via c-met a tyrosine receptor kinase (5). IL-32 synergized with the intracellular nuclear oligomerization domain receptors (NOD1- and NOD2-specific muropeptides of peptidoglycans for the release of IL-1beta and IL-6. In contrast, IL-32 did not influence the cytokine production induced via TLRs (6). The anti-IL32 selective antibodies were made against an epitope that lies near the C-terminal end of the protein. The antibodies to IL32 are affinity purified on immobilized affinity based chromatography and characterized for applications in ELISA and Western blotting. The antiIL32 antibodies recognize a single band of IL32 in PC-IL32 samples. The IL32 antibodies do not cross react with other pro-inflammatory or anti-inflammatory interleukins, has also produced antibodies to other interleukins, interleukin receptors, cytokines and their receptors.

Long Name

Interleukin 32

Alternate Names

IL32, NK4, TAIF

Gene Symbol

IL32

Additional IL-32 Products

Product Documents for IL-32 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IL-32 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.