LAMP-1/CD107a Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-59780PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-59780PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all LAMP-1/CD107a Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAMP-1/CD107a

Source: E. coli

Amino Acid Sequence: NFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59780.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-59780PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: LAMP-1/CD107a

LAMP-1 (lysosome-associated membrane protein 1), also known as CD107a (cluster of differentiation 107a), is a major component of lysosomal membranes that plays an important role in lysosomal biogenesis, autophagy, and cholesterol metabolism (1). LAMP-1 is a type I transmembrane glycoprotein that is expressed on plasma membranes and the membranes of endosomes, autolysosomes, and lysosomes (1,2). Additionally, LAMP-1/CD107a is a commonly used marker for natural killer (NK) cell degranulation (3). LAMP-1 and another lysosomal-associated membrane protein, LAMP-2, together make up about half of all lysosome membrane proteins (1). Additionally, LAMP-1 has a role in presenting carbohydrate ligands to selectins (2). Human LAMP-1 protein is comprised of 417 amino acids (aa) with a theoretical molecular weight of 44.8 kDa; however, glycosylation can increase the molecular weight upwards of 120 kDa (1, 4). Structurally, LAMP-1 protein contains a large luminal/extracellular domain (29-382 aa), a helical transmembrane domain (383-405 aa), and a short cytoplasmic tail (406-417 aa) (1,2). Additionally, the protein has many N- and O-linked glycosylation sites which helps with stability in the membrane (1,2).

LAMP-1 plays an important role in autophagy-mediated ATP-release during apoptosis where lysosomes containing intracellular ATP migrate to the plasma membrane and, during exocytosis, LAMP-1 is exposed to the cell surface (5). Studies have found that knockdown of LAMP-1 blocks the ATP release from the cell (5). Furthermore, an absence of LAMP-1 and LAMP-2 leads to an accumulation of lysosomal cholesterol (6). Lysosomal membrane dysfunction or defects has also been associated with disease development (6,7). For example, one feature of pancreatitis is autophagy impairment which is caused by lysosomal dysfunction and a corresponding decrease in lysosomal-membrane associated proteins LAMP-1 and LAMP-2 (7).

References

1. Eskelinen E. L. (2006). Roles of LAMP-1 and LAMP-2 in lysosome biogenesis and autophagy. Molecular aspects of medicine, 27(5-6), 495-502. https://doi.org/10.1016/j.mam.2006.08.005

2. Cheng, X. T., Xie, Y. X., Zhou, B., Huang, N., Farfel-Becker, T., & Sheng, Z. H. (2018). Revisiting LAMP1 as a marker for degradative autophagy-lysosomal organelles in the nervous system. Autophagy, 14(8), 1472-1474. https://doi.org/10.1080/15548627.2018.1482147

3. Krzewski, K., & Coligan, J. E. (2012). Human NK cell lytic granules and regulation of their exocytosis. Frontiers in immunology, 3, 335. https://doi.org/10.3389/fimmu.2012.00335

4. Uniprot (P11279)

5. Wang, Y., Martins, I., Ma, Y., Kepp, O., Galluzzi, L., & Kroemer, G. (2013). Autophagy-dependent ATP release from dying cells via lysosomal exocytosis. Autophagy, 9(10), 1624-1625. https://doi.org/10.4161/auto.25873

6. Schwake, M., Schr0der, B., & Saftig, P. (2013). Lysosomal membrane proteins and their central role in physiology. Traffic (Copenhagen, Denmark), 14(7), 739-748. https://doi.org/10.1111/tra.12056

7. Gukovsky, I., Pandol, S. J., Mareninova, O. A., Shalbueva, N., Jia, W., & Gukovskaya, A. S. (2012). Impaired autophagy and organellar dysfunction in pancreatitis. Journal of gastroenterology and hepatology, 27 Suppl 2(Suppl 2), 27-32. https://doi.org/10.1111/j.1440-1746.2011.07004.x

Long Name

Lysosome-associated Membrane Glycoprotein 1

Alternate Names

CD107a, LAMP1

Gene Symbol

LAMP1

Additional LAMP-1/CD107a Products

Product Documents for LAMP-1/CD107a Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LAMP-1/CD107a Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.