Recombinant Human LRP-1 GST (N-Term) Protein

Name: Recombinant Human LRP-1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00004035-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00004035-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all LRP-1 Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-292 of Human LRP1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human LRP-1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00004035-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: LRP-1

LRP-1 (low-density lipoprotein receptor-related protein 1) is a large type I transmembrane protein belonging to the LDL receptor superfamily. The extracellular domain of LRP-1 is organized in four clusters of ligand-binding repeats that recognizes at least 30 different ligands. The amino acid sequence of human and mouse LRP-1 cluster II share 100% identity.

Long Name

LDL Receptor-related Protein 1

Alternate Names

A2MR, Alpha-2-Macroglobulin Receptor, APOER, Apolipoprotein E receptor, APR, CD91, CD91 antigen, EC 1.1.1.94, EC 3.4.21.9, IGFBP3R, low density lipoprotein receptor-related protein 1, LRP, LRP-1, LRP1A, prolow-density lipoprotein receptor-related protein 1, TbetaR-V/LRP-1/IGFBP-3 receptor, TGFBR5, type V tgf-beta receptor

Gene Symbol

LRP1

Additional LRP-1 Products

Product Documents for Recombinant Human LRP-1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human LRP-1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews