LRRC3 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88289PEP
Key Product Details
Source
E. coli
Tag
N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LRRC3.
Source: E. coli
Amino Acid Sequence: GAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEFVGKP
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88289.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
For further blocking peptide related information and a protocol, click here.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP1-88289PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: LRRC3
LRRC3 (Leu-rich repeat/LRR-containing protein 3) is a 25 kDa (predicted) member of the Leu-rich repeat protein superfamily. Little is known about the protein except for the fact that it shows widespread expression. Human LRRC3 is a protein that is 225 amino acids (aa) in length (SwissProt #:Q9BY71). It contains three LRRs between aa 63-86, aa 87-110, and aa 112-135. There is one potential splice variant that shows a deletion of aa 129-248. Over aa 33-204, human LRRC3 is 83% and 81% aa identical to mouse and canine LRRC3, respectively.
Long Name
Leucine-rich Repeat Containing 3
Alternate Names
C21orf102, chromosome 21 open reading frame 102, leucine rich repeat containing 3, leucine-rich repeat-containing protein 3, LRRC3A
Gene Symbol
LRRC3
Additional LRRC3 Products
Product Documents for LRRC3 Recombinant Protein Antigen
Product Specific Notices for LRRC3 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...