MBP-1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88573PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-88573PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all MBP-1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MBP-1.

Source: E. coli

Amino Acid Sequence: GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88573.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-88573PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MBP-1

PRG2, also known as Bone marrow proteoglycan, is a 222 amino acid protein that is 25 kDa, found in high levels of the proform in placenta and pregnancy serum, may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions; is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases; and the proform acts as a proteinase inhibitor, reducing the activity of PAPPA. Disease research is currently being studied in relation to PRG2 and malignant peripheral nerve sheath tumor, epithelioid malignant peripheral nerve sheath tumor, ocular cicatricial pemphigoid, cicatricial pemphigoid, giant papillary conjunctivitis, vernal keratoconjunctivitis, corneal ulcer, allergic rhinitis, eosinophilic gastroenteritis, papillary conjunctivitis, hypereosinophilic syndrome, eosinophilia, pulmonary eosinophilia,connective tissue disease, kimura disease, rhinitis, retinal detachment, keratoconjunctivitis, eosinophilic esophagitis, and familial eosinophilia. The protein has been shown to interact with CHD3, PAPPA, PRKCZ, AGT, CSF2, and other proteins in MAPK Signaling, Molecular Mechanisms of Cancer, PTEN Pathway, Transendothelial Migration of Leukocytes, UPA-UPAR Pathway, Selected targets of C/EBPbeta and Asthma pathways.

Long Name

Major basic protein

Alternate Names

BMPG, EMBP, PRG2

Gene Symbol

PRG2

Additional MBP-1 Products

Product Documents for MBP-1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MBP-1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.