Skip to main content

MCPIP1/ZC3H12A Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83587PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-83587PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZC3H12A.

Source: E. coli

Amino Acid Sequence: AFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGRSPWGRAGSLAKEQASVYTKLCGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83587.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-83587PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MCPIP1

Monocyte chemoattractant protein-induced protein 1 (MCPIP1), also referred to as ZC3H12A and Regnase-1, is an endonuclease that cleaves and destabilizes mRNA and functions as a negative regulator of inflammation (1,2). MCPIP1 is encoded by the ZC3H12A gene as a protein of 599 amino acids (aa) in length with a theoretical molecular weight of approximately 66 kDa (3-5). Common structural features of the MCPIP1 protein are the ubiquitin-associated (UBA) domain (43-89 aa), two protein-rich regions (PRRs) (100-126 aa, 458-536 aa), the PilT N-terminal (PIN) domain (133-270 aa), the zinc-finger motif (305-325 aa), the natively disordered region (326-457 aa), and the C-terminal conserved region (CCR) (545-598 aa) (1,3-5). MCPIP1 functions as an anti-inflammatory protein with RNase activity that is known to degrade many cytokine mRNA transcripts including interleukin-1beta (IL-1beta), IL-6, and IL-17 (4,5). In addition to its regulation of inflammation through mRNA degradation, MCPIP1 also controls inflammation through ubiquitin-specific peptidase 10 (USP10)-mediated protein deubiquitination of TRAF6 which results in suppression of c-Jun N-terminal kinase (JNK) and nuclear factor kappa B (NFkappaB) transcription factors (1,2,5). Besides regulating inflammation, MCPIP1 is involved in several non-immune cellular processes including apoptosis, adipogenesis, angiogenesis, and proliferation (2,5). MCPIP1 has also been implicated in a number of autoimmune diseases and other pathologies including chronic obstructive pulmonary disease (COPD), diabetes, rheumatoid arthritis, and cancer (3,5). Additionally, MCPIP1/ZC3H12A has been shown to have anti-viral activity against RNA viruses such as Japanese encephalitis virus and human immunodeficiency virus (HIV)-1 (1,5).

References

1. Uehata, T., & Takeuchi, O. (2017). Regnase-1 Is an Endoribonuclease Essential for the Maintenance of Immune Homeostasis. Journal of interferon & cytokine research: the official journal of the International Society for Interferon and Cytokine Research, 37(5), 220-229. https://doi.org/10.1089/jir.2017.0001

2. Miekus, K., Kotlinowski, J., Lichawska-Cieslar, A., Rys, J., & Jura, J. (2019). Activity of MCPIP1 RNase in tumor associated processes. Journal of experimental & clinical cancer research : CR, 38(1), 421. https://doi.org/10.1186/s13046-019-1430-6

3. Jura, J., Skalniak, L., & Koj, A. (2012). Monocyte chemotactic protein-1-induced protein-1 (MCPIP1) is a novel multifunctional modulator of inflammatory reactions. Biochimica et biophysica acta, 1823(10), 1905-1913. https://doi.org/10.1016/j.bbamcr.2012.06.029

4. Xu, J., Fu, S., Peng, W., & Rao, Z. (2012). MCP-1-induced protein-1, an immune regulator. Protein & cell, 3(12), 903-910. https://doi.org/10.1007/s13238-012-2075-9

5. Musson, R., Szukala, W., & Jura, J. (2020). MCPIP1 RNase and Its Multifaceted Role. International journal of molecular sciences, 21(19), 7183. https://doi.org/10.3390/ijms21197183

Long Name

MCP-1-induced Protein 1

Alternate Names

ZC3H12A

Gene Symbol

ZC3H12A

Additional MCPIP1 Products

Product Documents for MCPIP1/ZC3H12A Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MCPIP1/ZC3H12A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...