MMP-2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-54667PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-54667PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all MMP-2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMP2.

Source: E. coli

Amino Acid Sequence: YGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54667.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-54667PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MMP-2

MMP2 is a member of the Matrix Metalloproteinase (MMP) family, which are involved in extracellular matrix degradation under both normal physiological and disease processes. Specifically, MMP-2 is responsible for degrading collagens type IV, V, VII, and X and gelatin type I. Other reported functions of MMP 2 include angiogenesis, tumor invasion, tissue repair, remodeling of the vasculature, inflammation, and atherosclerotic plaque rupture. MMP-2 secretion is activated by the Ras signaling pathway. MMP2 triggers cells to begin migration by cleaving laminin-5 and exposing an integrin-binding site on the epithelial basement membrane. The cleaved of laminin has been detected in tumors and in tissues being altered, howver the activated form of MMP2 is not found in benign tumors. Thus, detection of MMP2 is a possible early indicator of tumor activity. MMP2 is most strongly expressed in normal skin fibroblasts, but may also be found in gliomas, breast and prostate tumors. Mutations in the MMP-2 gene have been linked to Torg-Winchester syndrome, Nodulosis-Arthropathy-Osteolysis (NAO) syndrome, and arthritis. Additionally, abnormal expression of matrix matalloproteinases have been associated with neoplastic traits such as loss of negative growth regulation and high invasive potential.

Long Name

Matrix Metalloproteinase 2

Alternate Names

Gelatinase A, MMP2

Gene Symbol

MMP2

Additional MMP-2 Products

Product Documents for MMP-2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MMP-2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.