Skip to main content

MRGX2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33744PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33744PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRGPRX2.

Source: E. coli

Amino Acid Sequence: ALQRALQDIAEVDHSEGCFRQGTPEMSRSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33744.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33744PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MRGX2

MRGX2 (MAS-related GPR, member X2) is G-protein coupled 7-transmembrane protein that is selectively expressed in small-diameter sensory neurons of dorsal root ganglia. Human MRGX shares 41-52% amino acid identity with three other primate MRGX proteins, but has no ortholog in rodents. Binding of ligands such as cortistatin, proadrenaomedullin peptides (PAMP-12 and -20) and basic peptides (substance P, neuropeptide Y) to MRGX2 can activate Gq or Gi regulated pathways. MRGX2 is thought to influence nociception and promote adrenal gland catecholamine secretion and IgE-independent mast cell degranulation.

Long Name

Mas-related G Protein-coupled Receptor Member X2

Alternate Names

MRGPRX2

Gene Symbol

MRGPRX2

Additional MRGX2 Products

Product Documents for MRGX2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MRGX2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...