MTH1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-54664PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-54664PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all MTH1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTH1

Source: E. coli

Amino Acid Sequence: RWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54664.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-54664PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MTH1

Oxygen radicals damage chromosomal DNA causing cell death and inducing mutations. Among the various classes of DNA damage caused by oxygen radicals, an oxidized form of guanine base (8-oxoguanine) appears to be important as it can pair with cytosine and adenine and G:C to T:A transversion mutation occurs. A significant amount of 8-OxoG is formed in the chromosomal DNA of mammalian cells, with most damaged nucleotides excised from the DNA and excreted in the urine. Along with 8-oxoG being present in oxidatively damaged DNA, 8-oxo-deoxyguanosine (8-oxo-dGTP) is formed in the nucleotide pool during normal cellular metabolism and following oxidative stress. The 8-oxo-dGTP nucleotide can be incorporated in DNA during polymerization and can result in a mispairing unless repaired. MTH converts 8-oxo-dGTP in the nucleotide pool to the monophosphate and prevents the misincorporation of 8-oxo-dGTP into DNA (Figure courtesy of Dr. Mark Kelley). MTH also recognizes 8-oxo-rGTP, which could incorporate into RNA during gene transcription leading to missense or nonsense protein production.

Long Name

Oxidized purine nucleoside triphosphate hydrolase

Alternate Names

8-oxo-dGTPase, EC 3.6.1.-, EC 3.6.1.56, Nudix motif 1, NUDT1

Gene Symbol

NUDT1

Additional MTH1 Products

Product Documents for MTH1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MTH1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.