Skip to main content

MYH6 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-36745PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-36745PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYH6.

Source: E. coli

Amino Acid Sequence: QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-36745.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-36745PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MYH6

Skeletal muscle Myosin or Myosin II is the motor protein that generates force to drive muscle contraction. It is a 520 kDa hexamer comprised of two heavy chains and four light chains. Myosin heavy chain is 220 kDa in size and consists of a long coiled-coil domain tail that mediates dimerization of the two heavy chains and a globular head region that mediates ATP-dependent sliding of actin filaments. Myosin heavy chain can be proteolytically cleaved to produce heavy meromyosin, which includes the S1 motor domain (head region) and first third of the coiled coil domain, and light meromyosin, which includes the C-terminal two thirds of the coiled coil domain.

Long Name

Myosin Heavy Chain 6, Cardiac Muscle, Alpha

Alternate Names

alpha-MHC, ASD3, CMD1EE, CMH14, MyHC-Alpha, MYHCA, Myosin-6, SSS3

Gene Symbol

MYH6

Additional MYH6 Products

Product Documents for MYH6 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MYH6 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...