Neuropilin-1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85763PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-85763PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all Neuropilin-1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NRP1.

Source: E. coli

Amino Acid Sequence: EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85763.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-85763PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Neuropilin-1

Neuropilin-1 (also known as Npn-1, NRP1, neuropilin, or CD304/BDCA4) is a 923 amino acid (aa) type I transmembrane glycoprotein (theoretical molecular weight 130-140 kDa) located on human chromosome 10p11.22 that encodes multiple intact and soluble isoforms. The 623 aa extracellular domain (ECD) of this human cell surface receptor includes two CUB (complement-binding) domains, two F5/8 domains with homology to coagulation factors V and VIII, and a MAM (meprin) domain. The ECD of human Neuropilin-1 shares 92-95% aa sequence identity with mouse, rat, bovine, and canine Npn-1. The MAM domains of neuropilins are involved in the formation of homo- and hetero-oligomers in the absence of ligands. Neuropilin-1 expression is found in neuronal, endothelial and tumor cells as well as epithelial cells such as in the respiratory, gastrointestinal, lower urological tracts, thyroid, parathyroid and thymus gland (1,2).
Initially found to play an essential role in axon growth and guidance, NRP1 serves as a multifunctional co-receptor for class III semaphorins and heparin-binding members of the VEGF family, participating in regulation of angiogenesis, neuronal development, cell survival, migration and tumor-invasion. Neuropilin-1 has been implicated in viral infections and T-cell activation and is also described as a marker of regulatory T (Treg) cells (3). In COVID-19 infections, studies have shown NRP1 participates in viral infection via NRP1 neutralizing antibodies and binds the SARS-CoV-2 Spike protein, suggesting NRP1 may contribute to viral transport and viral internalization by endocytosis (4).

References

1. Wild JRL, Staton CA, Chapple K, Corfe BM. (2012) Neuropilins: Expression and Roles in the Epithelium. Int J Exp Pathol. 93(2):81-103. PMID: 22414290

2. Bielenberg DR, Pettaway CA, Takashima S, Klagsbrun M. (2006) Neuropilins in Neoplasms: Expression, Regulation, and Function. Exp Cell Res. 312(5):584-93. PMID: 16445911

3. Tordjman R, Lepelletier Y, Lemarchandel V, Cambot M, Gaulard P, Hermine O, Romeo P-H. (2002). A Neuronal Receptor, neuropilin-1, Is Essential for the Initiation of the Primary Immune Response. Nat Immunol. 3(5):477-82. PMID: 11953749

4. Coronavirus research updates: Test frequency matters more than test sensitivity for stopping outbreaks. 2002 June 26. Nature.com

Alternate Names

BDCA-4, CD304, Neuropilin1, NRP1

Gene Symbol

NRP1

Additional Neuropilin-1 Products

Product Documents for Neuropilin-1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Neuropilin-1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.