Neuropilin-1 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85763PEP
Key Product Details
Source
E. coli
Tag
N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NRP1.
Source: E. coli
Amino Acid Sequence: EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGE
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85763.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP1-85763PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Neuropilin-1
Initially found to play an essential role in axon growth and guidance, NRP1 serves as a multifunctional co-receptor for class III semaphorins and heparin-binding members of the VEGF family, participating in regulation of angiogenesis, neuronal development, cell survival, migration and tumor-invasion. Neuropilin-1 has been implicated in viral infections and T-cell activation and is also described as a marker of regulatory T (Treg) cells (3). In COVID-19 infections, studies have shown NRP1 participates in viral infection via NRP1 neutralizing antibodies and binds the SARS-CoV-2 Spike protein, suggesting NRP1 may contribute to viral transport and viral internalization by endocytosis (4).
References
1. Wild JRL, Staton CA, Chapple K, Corfe BM. (2012) Neuropilins: Expression and Roles in the Epithelium. Int J Exp Pathol. 93(2):81-103. PMID: 22414290
2. Bielenberg DR, Pettaway CA, Takashima S, Klagsbrun M. (2006) Neuropilins in Neoplasms: Expression, Regulation, and Function. Exp Cell Res. 312(5):584-93. PMID: 16445911
3. Tordjman R, Lepelletier Y, Lemarchandel V, Cambot M, Gaulard P, Hermine O, Romeo P-H. (2002). A Neuronal Receptor, neuropilin-1, Is Essential for the Initiation of the Primary Immune Response. Nat Immunol. 3(5):477-82. PMID: 11953749
4. Coronavirus research updates: Test frequency matters more than test sensitivity for stopping outbreaks. 2002 June 26. Nature.com
Alternate Names
BDCA-4, CD304, Neuropilin1, NRP1
Gene Symbol
NRP1
Additional Neuropilin-1 Products
Product Documents for Neuropilin-1 Recombinant Protein Antigen
Product Specific Notices for Neuropilin-1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...