Skip to main content

Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00001134-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00001134-Q01-25ug
H00001134-Q01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Flow Cytometry, Affinity Purification, Microarray, SDS-PAGE, Western Blot

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 146-231 of Human Nicotinic Acetylcholine R alpha 1/CHRNA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Application Notes

Use in FLOW cytometry and blocking/ neutralizing reported in scientific literature ( PMID 25050620)

Protein / Peptide Type

Recombinant Protein

Scientific Data Images

SDS-PAGE: Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 GST (N-Term) Protein [H00001134-Q01]

SDS-PAGE: Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 GST (N-Term) Protein [H00001134-Q01]

SDS-Page: Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 Protein [H00001134-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00001134-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 1/CHRNA1

The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Long Name

Nicotinic Acetylcholine Receptor alpha 1

Alternate Names

ACHRA, CHRNA1, CMS2A, FCCMS, nAChR alpha 1, nAchRa1, Nicotinic Acetylcholine Ra1, SCCMS

Gene Symbol

CHRNA1

Additional Nicotinic Acetylcholine R alpha 1/CHRNA1 Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...