Recombinant Mouse OX40 Ligand/TNFSF4 Protein
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-26577
Key Product Details
Conjugate
Applications
Product Specifications
Description
Amino Acid Sequence:
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKSGRQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Mouse Ig-Fc amino acid sequence, followed by linker (SGR) in bold and
Extracellular mouse OX40L amino acid sequence is underlined
Purity
Endotoxin Level
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Applications
In vitro assay (reported in scientific literature (PMID 24633226))
Protein / Peptide Type
Scientific Data Images for Recombinant Mouse OX40 Ligand/TNFSF4 Protein
In vitro assay: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]
In vitro assay: TNFSF4 Protein [NBP2-26577] - Demonstration in vitro of the potency of Fc-OX40L in comparison to an agonist antibody OX86, with anti-CD3 alone serving as a negative control for co-stimulation.SDS-PAGE: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]
SDS-Page: TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-20% reducing SDS-PAGE.SDS-PAGE: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]
SDS-Page: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-15% reducing SDS-PAGE.Formulation, Preparation and Storage
NBP2-26577
Formulation | Phosphate-buffered solution, pH 7.2, containing no preservative. 0.2 um filter sterilized. |
Preservative | No Preservative |
Concentration | 2 mg/ml |
Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: OX40 Ligand/TNFSF4
Alternate Names
Gene Symbol
Additional OX40 Ligand/TNFSF4 Products
Product Documents for Recombinant Mouse OX40 Ligand/TNFSF4 Protein
Product Specific Notices for Recombinant Mouse OX40 Ligand/TNFSF4 Protein
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.