Skip to main content

Recombinant Human Perforin GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00005551-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00005551-Q01-25ug
H00005551-Q01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 461-555 of Human Perforin

Source: Wheat Germ (in vitro)

Amino Acid Sequence: WSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Perforin GST (N-Term) Protein

SDS-PAGE: Recombinant Human Perforin GST (N-Term) Protein [H00005551-Q01]

SDS-PAGE: Recombinant Human Perforin GST (N-Term) Protein [H00005551-Q01]

SDS-Page: Recombinant Human Perforin Protein [H00005551-Q01] - Partial recombinant protein with N-terminal GST tag on 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00005551-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Perforin

The protein encoded by this gene has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in this gene cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq]

Long Name

Perforin 1 (Pore Forming Protein)

Alternate Names

Cytolysin, FLH2, HPLH2, P1, PFP, PRF1

Gene Symbol

PRF1

Additional Perforin Products

Product Documents for Recombinant Human Perforin GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Perforin GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...