Recombinant Human PERP GST (N-Term) Protein

Name: Recombinant Human PERP GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00064065-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00064065-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all PERP Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-193 of Human PERP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

47.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human PERP GST (N-Term) Protein

SDS-PAGE: Recombinant Human PERP GST (N-Term) Protein [H00064065-P01]

SDS-Page: Recombinant Human PERP Protein [H00064065-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00064065-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: PERP

The p53 tumor suppressor activates either cell cycle arrest or apoptosis in response to cellular stress. A novel gene, PERP, is expressed in a p53-dependent manner and at high levels in apoptotic cells compared with G(1)-arrested cells. PERP induction is linked to p53-dependent apoptosis and is directly activated by p53. These data suggest that PERP is a novel effector of p53-dependent apoptosis.

Alternate Names

dJ496H19.1, KCP1KCP-1, Keratinocyte-associated protein 1, KRTCAP11110017A08Rik, p53 apoptosis effector related to PMP22, p53 apoptosis effector related to PMP-22, P53-induced protein PIGPC1, PERP, TP53 apoptosis effector, PIGPC1RP3-496H19.1, THWkeratinocytes associated protein 1, Transmembrane protein THW

Gene Symbol

PERP

Additional PERP Products

Product Documents for Recombinant Human PERP GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human PERP GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews