Recombinant Human POLR2L GST (N-Term) Protein

Name: Recombinant Human POLR2L GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00005441-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00005441-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all POLR2L Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-67 of Human POLR2L

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human POLR2L GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00005441-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: POLR2L

This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases. POLR2L( AAH18649, 1 a.a. - 68 a.a.) recombinant protein with GST.

Alternate Names

DNA-directed RNA polymerase III subunit L, DNA-directed RNA polymerases I, II, and III subunit RPABC5, EC 2.7.7.6, hRPB7.6, hsRPB10b, polymerase (RNA) II (DNA directed) polypeptide L (7.6kD), polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa, RBP10, RNA polymerase II 7.6 kDa subunit, RPABC5, RPB10, RPB10 homolog, RPB10beta, RPB7.6RNA polymerases I, II, and III subunit ABC5

Gene Symbol

POLR2L

Additional POLR2L Products

Product Documents for Recombinant Human POLR2L GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human POLR2L GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews