An un-tagged recombinant protein corresponding to the amino acids 37-469 of Protein A

Source: E.coli

Amino Acid Sequence: MAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDNKKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPET

Purity

>90%, by SDS-PAGE

Endotoxin Level

< 1.0 EU per 1 microgram of protein (determined by LAL method)

Predicted Molecular Mass

48.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant S. aureus Protein A Protein

SDS-PAGE: Recombinant S. aureus Protein A Protein [NBP3-07005]

SDS-Page: Recombinant S. aureus Protein A Protein [NBP3-07005] - Protein A, 48.1 kDa (434aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE.

Formulation, Preparation and Storage

NBP3-07005

Formulation	20 mM Tris-HCl buffer (pH 8.0), 10% glycerol
Preservative	No Preservative
Concentration	1 mg/ml
Shipping	The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Protein A

Protein A is a surface protein of S.aureus which binds IgG molecules by their Fc region. In serum, the bacteria will bind IgG molecules in the wrong orientation on their surface which hinders opsonization and phagocytosis. Mutants of S. aureus lacking protein A are more efficiently phagocytosed in vitro, and mutants in infection models have diminished virulence. Due to its affinity for the Fc region of many mammalian immunoglobulins, protein A is considered a universal reagent in biochemistry and immunology.

Alternate Names

PROA, Protein-A

Gene Symbol

SAOUHSC_00069

Additional Protein A Products

Product Documents for Recombinant S. aureus Protein A Protein

Product Datasheets

Download Product Datasheets

COA

Product Specific Notices for Recombinant S. aureus Protein A Protein

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews

Recombinant S. aureus Protein A Protein

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-07005

Key Product Details

Source

Conjugate

Applications

View all Protein A Proteins and Enzymes »

Product Specifications

Description