RBM8A Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88376PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-88376PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all RBM8A Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBM8A.

Source: E. coli

Amino Acid Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88376.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-88376PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RBM8A

Pre-mRNA splicing appears to play an important role in regulation of gene expression. It has been shown in a number of studies that during the splicing process, specific proteins are recruited to the mRNA and assemble into a complex of mRNA-protein near the exon-exon junction. This complex is termed mRNA-protein complex (mRNP), or the exon-exon junction complex. Several proteins were found to be present in this complex including Y14, magoh, Aly/REF, RNPS1, Upf3, and DEK. Y14 is a 174 amino acid RNA-binding protein that contains one RNA-binding domain in the middle of the protein. Y14 binds to the spliced mRNAs in the nucleus and is exported with the mRNA to the cytoplasm. Similar to other proteins in the mRNA-protein complex, Y14 can interact with the mRNA export factor TAP and enhance the export of the mRNAs. Y14 binds to different mRNAs approx.

Alternate Names

Binder of OVCA1-1, BOV-1, BOV-1A, BOV-1B, BOV-1C, MDS014, RBM8BRBM8, ribonucleoprotein RBM8, Ribonucleoprotein RBM8A, RNA binding motif protein 8A, RNA binding motif protein 8B, RNA-binding motif protein 8A, RNA-binding protein 8A, RNA-binding protein Y14, Y14, ZNRP, ZRNP1

Gene Symbol

RBM8A

Additional RBM8A Products

Product Documents for RBM8A Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RBM8A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.