Skip to main content

Ribosomal Protein L17 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48845PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-48845PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ribosomal Protein L17.

Source: E. coli

Amino Acid Sequence: RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48845.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-48845PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Ribosomal Protein L17

Ribosomal Protein L17, also known as 60S ribosomal protein L23, is a 21kDa 184 amino acid protein with a shorter 17kDa 146 isoform and a longer 26kDa 228 isoform produced by alternative splicing. Ribosomal Protein L17 belongs to the L22P family of ribosomal proteins and can be found in the cytoplasm. Current research is being conducted on Ribosomal Protein L17 and its relationship to Treacher Collins syndrome, gastric cancer, pancreatitis and malaria. Ribosomal Protein L17 has been linked to the ribosome assembly, protein folding, cell proliferation and cell growth pathways where it interacts with RPL4, RPL11, RPL26, RPL27A and RPL35.

Alternate Names

RPL17, RPL23

Gene Symbol

RPL17

Additional Ribosomal Protein L17 Products

Product Documents for Ribosomal Protein L17 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Ribosomal Protein L17 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...