Recombinant Human RUNX1/CBFA2 GST (N-Term) Protein

Name: Recombinant Human RUNX1/CBFA2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00000861-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00000861-Q01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Gel Shift, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all RUNX1/CBFA2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 210-310 of Human RUNX1/CBFA2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human RUNX1/CBFA2 GST (N-Term) Protein

SDS-PAGE: Recombinant Human RUNX1/CBFA2 GST (N-Term) Protein [H00000861-Q01]

SDS-Page: RUNX1/CBFA2 Partial Protein [H00000861-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00000861-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: RUNX1/CBFA2

Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.

Long Name

Runt-related Transcription Factor 1

Alternate Names

AML1, CBFA2

Gene Symbol

RUNX1

Additional RUNX1/CBFA2 Products

Product Documents for Recombinant Human RUNX1/CBFA2 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human RUNX1/CBFA2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews