Skip to main content

STAT3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-52935PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-52935PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STAT3.

Source: E. coli

Amino Acid Sequence: GVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52935.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-52935PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: STAT3

Stat3 is a member of a group of proteins (Signal Transduction and Activators of Transcription) that act as both signal transducers for cytokines and growth factors, as well as transcription factors (1,2). Stats are activated by tyrosine phosphorylation in response to different ligands, after which they translocate to the cell nucleus (1). Stat3 is constitutively activated in a number of human tumors (3). Stat3 is activated by phosphorylation on tyrosine 705 which induces dimerization, nuclear translocation, and DNA binding While, Stat3-activated transcription seems to be regulated by serine phosphorylation at serine 727 (4)

Long Name

Signal Transducer and Activator of Transcription 3

Alternate Names

Acute-phase response factor, APRFMGC16063, DNA-binding protein APRF, FLJ20882, HIES, signal transducer and activator of transcription 3, signal transducer and activator of transcription 3 (acute-phase responsefactor)

Gene Symbol

STAT3

Additional STAT3 Products

Product Documents for STAT3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for STAT3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...