Skip to main content

STAT5A Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-46669PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-46669PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STAT5A.

Source: E. coli

Amino Acid Sequence: EGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46669.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-46669PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: STAT5a

Stat5 is part of a 7 protein family known as signal transducer and activator of transcription (STAT) which contributes to signal transduction by cytokine, hormone and growth factor (1). Signal transducer and activator of transcription 5 (Stat5) functions both in signal transduction and activation of transcription. It has been found that cytoplasmic Stat5 is translocated to the nucleus in response to phosphorylation. Stat5 225; tyrosine phosphorylation is activated predominantly by IL2 but also by IL-3, IL-5, IL-7, IL-9, IL-15, G-CSF andGM-CSF(2). Tyrosine phosphorylation is required for DNA-binding activity and dimerization. Serine phosphorylation is also required for maximal transcriptional activity. NCoA-1/SRC-1 acts as a coactivator for both the alpha- and beta-isoforms of Stat5 (3).

Long Name

Signal Transducer and Activator of Transcription 5

Alternate Names

MGF, signal transducer and activator of transcription 5A, STAT5

Gene Symbol

STAT5A

Additional STAT5a Products

Product Documents for STAT5A Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for STAT5A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...